SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000034338 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000034338
Domain Number 1 Region: 4-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.84e-19
Family Ribosomal protein L24e 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000034338
Sequence length 163
Comment (Macaca mulatta)
Sequence
MRIEKCYFCSGPIYPGHGMTFFRNDCKVFRFCKSKCHKKFKKKHNPHKVRWTKAFQKAAG
KELTVDNSFQFEKCRNEPIKYQRELWNKTIDTMKRVEEIKQKRQAKFIMNRLKKNKELQK
VQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDMDVEDAP
Download sequence
Identical sequences 9544.ENSMMUP00000034338 ENSMMUP00000034338 ENSMMUP00000034338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]