SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000034791 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000034791
Domain Number 1 Region: 238-344
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-29
Family Cadherin 0.00091
Further Details:      
 
Domain Number 2 Region: 445-569
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-27
Family Cadherin 0.00095
Further Details:      
 
Domain Number 3 Region: 346-449
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-24
Family Cadherin 0.0019
Further Details:      
 
Domain Number 4 Region: 562-674
Classification Level Classification E-value
Superfamily Cadherin-like 1.19e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 129-236
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-19
Family Cadherin 0.0048
Further Details:      
 
Domain Number 6 Region: 31-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000171
Family Cadherin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000034791
Sequence length 1009
Comment (Macaca mulatta)
Sequence
QQKRNCSLHLQREMIVLLFFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITK
LSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQ
VEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYF
SLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVVPPQQQRTGTALLTIRVLDSNDN
VPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPR
TGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEA
VSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAG
DSYTLTVVARDRGEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVS
ATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEAR
DAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAV
DADDGENARLTYSIVRGNEMNLFRMDWRTGELRTARRVPAKRDPQRPYELVIEVRDHGQP
PLSSTATLVVQLVDGAVEPQAGAGAEAEGQTSLDLTLILIIALGSVSFIFLLAMIVLVVR
CQREKKSAAAAAVVEIKTCCGRQARARKKKLSKSDIMLVQSSNVPSNPAQVPVEESGGFG
SHHHNQNYCYQVCLTPESAKTDLMFLKPCSPSRSTDTEHNPCGAIVTGYTDQQPDIISNA
FSRLYNSAFQEADIVSSKDSGHGDSEQGDSDHDATNRAHPSDIMTHNNLTENRLFLKSGK
ISMDLFSNCTEECKALGHSDRCWMPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPE
AQPGAERSFSTFGKEKALHSTLERKELDGLLSNTRAPYKPPYLTRKRIC
Download sequence
Identical sequences ENSMMUP00000034791 9544.ENSMMUP00000034791 ENSMMUP00000034791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]