SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000035810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000035810
Domain Number 1 Region: 699-1051
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.35e-119
Family Hect, E3 ligase catalytic domain 0.000000112
Further Details:      
 
Domain Number 2 Region: 2-346
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.49e-103
Family Regulator of chromosome condensation RCC1 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000035810
Sequence length 1057
Comment (Macaca mulatta)
Sequence
MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKKVRDVGCGLRHTVFVLDDGTVYTCGC
NDLGQLGHEKSRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLLG
SEECIRVPRNIKSLSDIQIIQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTS
PQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLR
SQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTQIA
CGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWYPYNGQCLPDTDSEE
YFCVKRIFSGGDQSFSHYSNPQNCGPPDDFRCPDPTKQIWTVNEVLIQKWLSYPSGRFPV
EIANEIDGTFSSSGCLNGSFLAVSNDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQ
QVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAP
LKVLENWWSVLEPPLFLKIVELFKEVVVHLLKLYKIGIPPSERRIFNSFLHTALKVLEIL
HRVNEKTGQIIQYDKFYIHEVQELIDIRNDYINWVQQQAYGMDVNHGLTELADIPVTICT
YPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVG
DAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSR
LIWFSDKTFEDSDLFHLIGVICGLAIYNFTIVDLHFPLALYKKLLKKKPSLDDLKELMPD
VGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAY
VDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKG
EYWAEHPTIKIFWEVFHELPLEKKQQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLP
VSHTCFNLLDLPKYTDKETLRSKLIQAIDHNEGFSLI
Download sequence
Identical sequences G7PDD3 H9ERW1
NP_001244507.1.72884 XP_005565776.1.63531 ENSMMUP00000035810 9544.ENSMMUP00000035810 ENSMMUP00000005917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]