SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000037206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000037206
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-86
Family SSRP1-like 0.00000495
Further Details:      
 
Domain Number 2 Region: 539-619
Classification Level Classification E-value
Superfamily HMG-box 8.77e-26
Family HMG-box 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000037206
Sequence length 709
Comment (Macaca mulatta)
Sequence
MAETLEFNDIYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGH
GLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLS
FDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEA
FAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVL
RLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEG
RLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFI
YVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA
KKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDE
SFNPGEEEEDVAEEFDSNASASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKK
GKDPNAPKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKA
EDARREYEKAMKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESF
KSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPSSEDSASGSDE
Download sequence
Identical sequences A0A2I3LQS5 A0A2K5NIF7 A0A2K6A5L0 A0A2K6BEU6 F7E0V3 G7PQ43
NP_001244820.1.72884 XP_005577929.1.63531 XP_011764383.1.29376 XP_011854094.1.47321 XP_011947736.1.92194 9544.ENSMMUP00000037206 ENSMMUP00000023416 ENSMMUP00000037206 ENSMMUP00000023416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]