SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000037210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000037210
Domain Number 1 Region: 109-221
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-29
Family C-type lectin domain 0.000000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000037210
Sequence length 222
Comment (Macaca mulatta)
Sequence
MKLLLLLALLFGAVSALHLRPETSTFDSTLGAKTLPEDEEMPEQEVEEILSRELEEEEEG
GSGSEDASKEDGAVKLISVPDMVDKNLTCPEEEDTVKVVGIPGCPTCRYLLVRSPHTFNQ
AWFTCQRCYRGNLASIHNFNTNSQIQWSVRALNQGQVWIGGRITGSGRCRRFQWVDGSRW
NFAYWAAHQPWSRGGHCVSLCTRGGHWRRAHCLRRLPFICSY
Download sequence
Identical sequences F7CG87
ENSMMUP00000013894 ENSMMUP00000013894 ENSMMUP00000037210 XP_002799599.1.72884 XP_014969648.1.72884 XP_014969649.1.72884 XP_014969650.1.72884 9544.ENSMMUP00000037210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]