SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000038051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000038051
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-16
Family I set domains 0.0097
Further Details:      
 
Domain Number 2 Region: 206-259
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000943
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000038051
Sequence length 268
Comment (Macaca mulatta)
Sequence
KNAIFRAVVCGEPRPEVHWQNSKGDLSDSSKYKISSSPGSKEHVLQINKLTGEDTDLYRC
TAVNMYGEATCSARLTVIEVGFRKNRKRHKEPQEDLRKELMDFRKLLKKRTTWGTRARAP
PAPEKKIDLEQVWQLLMTADRKDYEQICMKYGIVDYRGMLRKLQEMKKEQEDKMAQYINA
ISSLRHIRVTKEGIAKFDLELDLKDSQSKIYLYKDGEMIPYGFNNQTKHCLRRLGKRYEF
QIQDLRPEDSGIYQVKVEDAVVFSTELE
Download sequence
Identical sequences ENSMMUP00000038051 9544.ENSMMUP00000038051 ENSMMUP00000038051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]