SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000038826 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000038826
Domain Number 1 Region: 259-485
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-64
Family Nuclear receptor ligand-binding domain 0.000000000877
Further Details:      
 
Domain Number 2 Region: 135-210
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-27
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000038826
Sequence length 486
Comment (Macaca mulatta)
Sequence
MVMQFQELENPIQISPHCSCTPSGFFTEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYS
NVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAESLYQGETEVAEMPVTK
KPRMGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTMNEDSQG
RDLRQVTSTTKSCREKTELTPDQQNLLHYIMDSYSKQKMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSD
LLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLC
EIWDVQ
Download sequence
Identical sequences A0A2K5XS38 A0A2K6BCT3 G7PJA3
9544.ENSMMUP00000038826 ENSMMUP00000038826 ENSMMUP00000038826 XP_005572045.1.63531 XP_011760098.1.29376 XP_011822027.1.47321 XP_011888130.1.92194 XP_015008048.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]