SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000001345 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000001345
Domain Number 1 Region: 67-373
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0012
Further Details:      
 
Domain Number 2 Region: 362-472
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.6e-17
Family Anticodon-binding domain of Class II aaRS 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000001345
Sequence length 475
Comment (Pan troglodytes)
Sequence
MEGLLTRCRALPALATCSHQLSGYVPCRFHHCAPRRGRRLLLSRVFQPQNLREDRVLSLQ
DKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVIDQEMQAIGGQKVNMP
SLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAITALIASQKKLSYKQLPFL
LYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQQTYSLVCDAYCSLFNKLGLP
FVKVQADVGTIGGTVSHEFQLPVDIGEDRLAICPRCSFSANMETLDLSQMNCPACQGPLT
KTKGIEVGHTFYLGTKYSSIFNAQFTNVCGKPTLAEMGCYGLGVTRILAAAIEVLSTEDC
VRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEAVPQLHGEVLLDDRTHLTIGN
RLKDANKFGYPFVIIAGKRALEDPAHFEVWCQNTGEVAFLTKDGVMDLLTQVQTV
Download sequence
Identical sequences H2PZ38
9598.ENSPTRP00000001345 ENSPTRP00000001345 XP_003815038.1.60992 XP_513427.3.37143 ENSPTRP00000001345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]