SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000001547 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000001547
Domain Number 1 Region: 61-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000001547
Domain Number - Region: 19-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00375
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000001547
Sequence length 690
Comment (Pan troglodytes)
Sequence
MKRLPLLVVFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDN
ECGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNV
CIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTV
SAKDTLSNSTLTEFVKTVNNFVQRDTLVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSF
QKTTEFDTNSTDIALKVFFFDSYNMKRIHPHMNMDGDYINIFPKRKAAYDSNGNVAVAFL
YYKSIGPLLSSSDNFLLKPQNYDNSEEEERIISSVISVSMSSNPPTLYELEKITFTLSHR
KVTDRYKSLCAFWNYSPDTMNGSWSSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIG
IKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVG
INTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKIFYIFGYLS
PAGVVGFSAALGYRYYGTTKVCWLRTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHT
AGLKPEVSCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFI
FLFLCVLSRKIQEEYYRLFKNVPCCFGCLR
Download sequence
Identical sequences 9598.ENSPTRP00000001547 ENSPTRP00000001547 ENSPTRP00000001547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]