SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000002574 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000002574
Domain Number 1 Region: 20-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.32e-43
Family Pentraxin (pentaxin) 0.00000000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000002574
Sequence length 224
Comment (Pan troglodytes)
Sequence
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKGIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEESQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
Download sequence
Identical sequences H2Q0D1
9598.ENSPTRP00000002574 ENSPTRP00000002574 ENSPTRP00000002574 XP_001170732.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]