SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000003499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000003499
Domain Number 1 Region: 202-379
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-64
Family SPRY domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-22
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 82-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000214
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000003499
Sequence length 391
Comment (Pan troglodytes)
Sequence
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQDIKDALRRVQDV
KLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDPDTANPELILSEDRRSVQRGDLRQA
LPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWALGVCRENVNRKEKGELSAGNGF
WILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSATDGSLLFIFPEIPFSGT
LRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ
Download sequence
Identical sequences XP_011542587.1.92137 9598.ENSPTRP00000003499 ENSPTRP00000003499 ENSPTRP00000003499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]