SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000004949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000004949
Domain Number 1 Region: 45-419
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.96e-46
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 536-598
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000895
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000004949
Sequence length 653
Comment (Pan troglodytes)
Sequence
MSRMLLFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGD
FEIVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGRE
EIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGS
GRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPI
LSSSASDPFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDI
VYGNWNGPHRLYLQMSAHGKFRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAY
RSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESM
AQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEME
PVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQG
FSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGT
LGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSAVKESCEPSC
Download sequence
Identical sequences ENSPTRP00000004949 9598.ENSPTRP00000004949 ENSPTRP00000004949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]