SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000006168 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000006168
Domain Number 1 Region: 340-618
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-87
Family Eukaryotic proteases 0.000000000282
Further Details:      
 
Domain Number 2 Region: 103-197
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.00000771
Further Details:      
 
Domain Number 3 Region: 209-297
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-27
Family Kringle modules 0.00000612
Further Details:      
 
Domain Number 4 Region: 43-104
Classification Level Classification E-value
Superfamily GLA-domain 9.08e-20
Family GLA-domain 0.0000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000006168
Sequence length 622
Comment (Pan troglodytes)
Sequence
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKFAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPSEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDPDRAIEGRTATSEYQPFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
Download sequence
Identical sequences ENSPTRP00000006168 ENSPTRP00000006168 9598.ENSPTRP00000006168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]