SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000011659 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000011659
Domain Number 1 Region: 310-369
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000773
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 96-120
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000366
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000011659
Domain Number - Region: 241-263
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000392
Family CCCH zinc finger 0.0049
Further Details:      
 
Domain Number - Region: 395-424
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000549
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000011659
Sequence length 507
Comment (Pan troglodytes)
Sequence
MEEPAAPSEAHEAAGAQAGAEAAREGVSGPDLPVCEPSGESAAPDSALPHAARGWAPFPV
APVPAHLRRGGLRPAPASGGGAWPSPLPSRSSGIWTKQIICRYYIHGQCKEGENCRYSHD
LSGRKMATEGGVLPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFF
EAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPLQSSETERKQMAVGSG
LRFCYYASRGVCFRGESCMYLHGDICDMCGLQTLHPMDAAQREEHMRACIEAHEKDMELS
FAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHSFCIRCIRRWRSARQFENRIVKS
CPQCRVTSELVIPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH
EYPEGWGDEPPGPGGGSFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLQLASLLFKRFLS
LRDELPFSEDQWDLLHYELEEYFNLIL
Download sequence
Identical sequences A0A2J8IW97
ENSPTRP00000011659 9598.ENSPTRP00000011659 ENSPTRP00000011659 XP_003809264.1.60992 XP_510258.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]