SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000012839 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000012839
Domain Number 1 Region: 401-683
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.64e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000921
Further Details:      
 
Domain Number 2 Region: 224-398
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.62e-53
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0002
Further Details:      
 
Domain Number 3 Region: 685-792
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.31e-26
Family Anticodon-binding domain of Class II aaRS 0.0013
Further Details:      
 
Domain Number 4 Region: 163-223
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000262
Family TGS domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000012839
Sequence length 802
Comment (Pan troglodytes)
Sequence
MAAEALAAEAVASRLERQEEDIRWLWSEVERLRDEQLNAPYSCQAEGPCLTREVAQLRAE
NCDLRHRLCSLRLCLAEERSRQATLESAELEAAQEAGAQPPSSQSQDKDMKKKKMKESEA
DSEVKHQPIFIKERLKLFEILKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTT
PYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHIL
GEAMELYYGGHLCYGLPIENGFYYDVFIEDRAVSSTELSALENICKAIIKEKQPFERLEV
SKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNS
STYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPG
SCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEI
EKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQD
DAHIFCTVEQIEEEIKGCLRFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQN
SLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSKDGD
DKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEF
FEEGFMADVDLDHNCTLNKKIRNAQLAQYNFILVVGEKEKIDNAVNVRTRDNKIHGEILV
TSAIDKLKNLKKTRTLNAEEAF
Download sequence
Identical sequences 9598.ENSPTRP00000012839 ENSPTRP00000012839 ENSPTRP00000012839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]