SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000012981 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000012981
Domain Number 1 Region: 264-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.48e-34
Family Pentraxin (pentaxin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000012981
Sequence length 473
Comment (Pan troglodytes)
Sequence
MGSGNWEVTGPPCGSGCERPPGLPRGVHGQFRSAVCLSGLRWFRRFQEVTWTHLQSIASN
YNVSYNVDVRFRSLAEESQAVAQAVNRSQASVQGELAQLKAWVRKMQRRGRKVDTRLRAL
DLTLGERSQQRARERKAHKAQRDALQDSLACLEGLIHSQGARLAALEGRLPVAHPGTAAL
GPALVPTPTQPEELSPTSLKLQRDRQELRAASEHGGPPQDSSAPLQGRREPPASGSHRVL
SGTAPKDPRQQAWSPQEPGEICGVGPTLVFPNASTKNVVFLSPGFVTALRALSFCSWVRM
ASGRLGTLLSYATEDNDNKLVLHGRDSLLPGSIHFVIGDPAFRELPLQLLLDGQWHHICV
IWTSTQGRYWLHVDRRLVATGSRFREGYEIPPGGSLVLGQEQDSVGGGFDSSEAFVGSMS
GLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQRANCTCLERCP
Download sequence
Identical sequences 9598.ENSPTRP00000012981 ENSPTRP00000012981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]