SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000014162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000014162
Domain Number 1 Region: 151-284
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-28
Family C-type lectin domain 0.00074
Further Details:      
 
Domain Number 2 Region: 1-49
Classification Level Classification E-value
Superfamily PR-1-like 0.00000000235
Family PR-1-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000014162
Sequence length 294
Comment (Pan troglodytes)
Sequence
LVWATSSQLGCGRHLCSAGQTAIEAFVCAYSPGGNWEVNGKTIVPYKKGAWCSLCTASVS
GCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGR
FREEECSCVCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQRKGG
VLAQIKSQKVQDILAFYLGHLETTNEVIDSDFETRNFWIGLTYKTAKDSFRWATGEHQAF
TSFAFGQPDNHGFGNCVELQASAAFNWNDQRCKTRNRYICQFAQEHISLWGLGS
Download sequence
Identical sequences 9598.ENSPTRP00000014162 ENSPTRP00000014162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]