SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000014833 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000014833
Domain Number 1 Region: 20-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.96e-35
Family Laminin G-like module 0.000000138
Further Details:      
 
Domain Number 2 Region: 220-394
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000168
Family Laminin G-like module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000014833
Sequence length 402
Comment (Pan troglodytes)
Sequence
MESRGPLATSRLLLLLLLLLLRHTHQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMT
FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGA
GPRLDDGRWHQVEVKMEGDSVLLKVDGEEVLCLRQVSGPLTSKRHPIMRIALGGLLFPAS
NLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDI
PQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPL
VLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTS
FCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
Download sequence
Identical sequences H2QC52
XP_016786951.1.37143 ENSPTRP00000014833 9598.ENSPTRP00000014833 ENSPTRP00000014833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]