SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000014877 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000014877
Domain Number 1 Region: 60-337
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-89
Family Protein kinases, catalytic subunit 0.00000000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000014877
Sequence length 344
Comment (Pan troglodytes)
Sequence
MAQKENAYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRCNVQPTAAPGQKVMEN
SSGTPNILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSRTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRTHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPTGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Download sequence
Identical sequences H2QC74
9598.ENSPTRP00000014877 XP_016787933.1.37143 XP_016802258.1.37143 ENSPTRP00000014877 ENSPTRP00000014877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]