SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000019900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000019900
Domain Number 1 Region: 39-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.85e-25
Family SCAN domain 0.0016
Further Details:      
 
Domain Number 2 Region: 349-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.81e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 310-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000123
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000019900
Domain Number - Region: 396-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0246
Family Classic zinc finger, C2H2 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000019900
Sequence length 433
Comment (Pan troglodytes)
Sequence
MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQ
ELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCNDKAGVKEKWKSSGKNLERFIE
DLTDDSINPPALVHVHMQGQEALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQD
TSLETGQGYEDEQDAWNSSLKTTQVNENITNQGNQIVSLIIIQEENGPRPEEGGVSSDNP
YNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQSSPESALTHQSNEGNSTCEV
HQKGSHGVRKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFFQISDLRVHQI
IHTGKKPFTCSICKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK
ITLPSVPSTPEAS
Download sequence
Identical sequences A0A2J8JLU2
9598.ENSPTRP00000019900 ENSPTRP00000019900 ENSPTRP00000019900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]