SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000021037 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000021037
Domain Number 1 Region: 37-210
Classification Level Classification E-value
Superfamily Lysozyme-like 1.31e-24
Family G-type lysozyme 0.00000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000021037
Sequence length 212
Comment (Pan troglodytes)
Sequence
MLSSVVFWGLIALIGTSRGSYPFTHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMN
CGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRG
LKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFK
SGIEAIATPSDIDNDFVNDIIARAKFYKRQSF
Download sequence
Identical sequences A0A2I3S5Y2 G1QNT8
ENSNLEP00000002604 ENSPTRP00000021037 9598.ENSPTRP00000021037 ENSNLEP00000002604 ENSPTRP00000021037 XP_003279286.1.23891 XP_003805457.1.60992 XP_009441243.1.37143 XP_016804583.1.37143 XP_016804584.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]