SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000023779 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000023779
Domain Number 1 Region: 764-1018
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-89
Family Eukaryotic proteases 0.000000036
Further Details:      
 
Domain Number 2 Region: 344-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-38
Family MAM domain 0.0089
Further Details:      
 
Domain Number 3 Region: 523-633
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 4 Region: 231-335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-17
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 5 Region: 59-164
Classification Level Classification E-value
Superfamily SEA domain 1.44e-16
Family SEA domain 0.0071
Further Details:      
 
Domain Number 6 Region: 673-774
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000144
Family Scavenger receptor cysteine-rich (SRCR) domain 0.01
Further Details:      
 
Domain Number 7 Region: 640-678
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000128
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 183-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000641
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000023779
Sequence length 1019
Comment (Pan troglodytes)
Sequence
MGSKRSVSSRHHSLSSYEIMFAALFAILVVLCAGLIAVSCLTIKESQRGATLGQSHEARG
TFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSII
VIFDLFFAQWVSDENVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLASPGNV
SIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQA
THYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDILDIYEGVGSSKILRASIWETN
PGTIRIFSNQVTATFLIESDESDYVGFNVTYTAFNSSELNNYEKINCNFEDGFCFWVQDL
NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEP
ACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKVAFN
AFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSSM
NFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPG
PVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKEDHFQCKNGECVPLVN
LCDGHLHCEDGSDEADCVRFFNGTMNNNGLVRFRIQSIWHTACAENWTIQISNDVCQLLG
LGSGNSSVPIFSTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLAAQD
ITPKIVGGSNAKEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAI
LGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPICLPEE
NQVFPPGRNCSIAGWGTVVYQGTTANILQEADVPLLSNEKCQQQMPEYNITENMICAGYE
EGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH
Download sequence
Identical sequences ENSPTRP00000023779 ENSPTRP00000023779 9598.ENSPTRP00000023779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]