SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000024729 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000024729
Domain Number 1 Region: 142-353
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.97e-66
Family Arfaptin, Rac-binding fragment 0.0016
Further Details:      
 
Domain Number 2 Region: 18-100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-17
Family PDZ domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000024729
Sequence length 416
Comment (Pan troglodytes)
Sequence
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
EVDLAHTTLAYGLNQEEFTDGEEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS
Download sequence
Identical sequences K7B0P0
ENSPTRP00000024729 9598.ENSPTRP00000024729 ENSPTRP00000024729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]