SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000025282 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000025282
Domain Number 1 Region: 890-1100
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.64e-40
Family DBL homology domain (DH-domain) 0.0024
Further Details:      
 
Domain Number 2 Region: 1259-1460
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-32
Family Pleckstrin-homology domain (PH domain) 0.0000886
Further Details:      
 
Domain Number 3 Region: 1090-1207
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-23
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000025282
Sequence length 1462
Comment (Pan troglodytes)
Sequence
MFRGPKPPIAPKPRLTAPNEWRASVYLNDSLNKCSNGRLPCVDRGLDEGPRSVPKCSESE
TDEDYIVVPRVPLREDEPKDEGSVGNKALVSPESSAEEEEEREEGGEACGLEGTGAGEDS
VAPAAPGAGALSREGEEGTDLALEDEGEGCADEPGTLEQVSRSEEEEKLVQPHRECSLED
SGPWAGEGVFQSDLLLPHIHGEDHEPPDTPGEAEEDDEEGCASTDPAGADEGSGPDRPTE
DMGQDAEDTSEEPPEKEELAGVQEAEAATDCPEVLEEGCEEATGVTGGEQVDLSEPPDHE
KKTNQEVAAATLEDHTQDESAEESCQIVPFENDCMEDFVTSLTGSPYEFFPTESTSFCSE
SCSPLSESAKGLESEQAPKLGLRAEENPMVGALCGQCGSLQGGVAEGPAAPGVVVVLEEE
ALDDALANPYVMGVGLPGQAAPGEGGQAASDALGGYGSKEELNCEAEGGLVPADRKNTST
RVRPHSGKVAGYVPETVPEETGPEAGSSAPGIGSAAEEVGKTLLSLEGKPLEASRALPAK
PRAFTLYPRSFSVEGREIPVSVYQEPEGSGLDDHRIKRKEDNLSLSCVIGSSGSFSQRNH
LPSSGTSTPSSMVDIPPPFDLACITKKPITKSSPSLLIHSDSPDKYKKKKSSFKRFLALT
FKKKTENKLHVDVNVSSSRSSSESSYHGPSRILEVDRRSLSNSPQLKSRTGKLRASESPS
SLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAM
NSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQDA
ESAYTEPYKVCPISSAAPKEDLTSDEEQRSSEEEDSASRDPSVTHKVEGQSRALVIAQEL
LSSEKAYVEMLQHLNLDFHGAVMRALDDMHHEGRDTLAREELRQGLSELPAIHDLHQGIL
EELEERLSNWESQQKVADVFLAREQGFDHHATHILQFDRYLGLLSENCLHSPRLAAAVRE
FEQSIQGGSQTAKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDR
ANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVL
LYTYPQKDGKYRLKNTLAVANMKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYG
CLSRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLR
RHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRAVPGLMRERPVSMSF
PLSSPRFSGSAFSSVFQSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKRGKRHW
KKLWFVIKGKVLYTYMASEDKVAMESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYS
FKAEDTNSAQRWIEAMEDASVL
Download sequence
Identical sequences H2QM43
ENSPTRP00000025282 ENSPTRP00000025282 9598.ENSPTRP00000025282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]