SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000025911 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000025911
Domain Number 1 Region: 490-628
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-30
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1454-1502,1583-1694
Classification Level Classification E-value
Superfamily FAS1 domain 3.79e-28
Family FAS1 domain 0.003
Further Details:      
 
Domain Number 3 Region: 1696-1849
Classification Level Classification E-value
Superfamily FAS1 domain 1.31e-24
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 4 Region: 946-1103
Classification Level Classification E-value
Superfamily FAS1 domain 1.14e-22
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 5 Region: 2180-2241
Classification Level Classification E-value
Superfamily C-type lectin-like 6.79e-21
Family Link domain 0.0018
Further Details:      
 
Domain Number 6 Region: 367-480
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-20
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 7 Region: 2236-2399
Classification Level Classification E-value
Superfamily FAS1 domain 2.62e-16
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 8 Region: 1121-1212
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000235
Family FAS1 domain 0.0084
Further Details:      
 
Domain Number 9 Region: 1525-1563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Merozoite surface protein 1 (MSP-1) 0.065
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000025911
Domain Number - Region: 787-886,915-970
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 1979-2119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00119
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 1351-1483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 212-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 2122-2158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0136
Family EGF-like domain of nidogen-1 0.072
Further Details:      
 
Domain Number - Region: 718-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0774
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000025911
Sequence length 2507
Comment (Pan troglodytes)
Sequence
MAGPRGLLPLCLLAFCLAGFSFVRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWL
RELPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPC
NGHGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCRCVHGVCNHGPRGDGS
CLCFAGYTGPHCDQEAPSCRCLPGYTQQGSECRAPNPCWPSPCSLLAQCSVSPKGQAQCH
CPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFCTCRPGLVSINSNASAGCF
AFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLLHEVQKATQTGRVFLQLRV
AVAMMDQGCREILTTAGPFTVLVPSVSSFSSRTMNASLAQQLCRQHIIAGQHILEDTRTQ
QTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANNIAANGVFHVVTGLRWQAP
SGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGPFTVFAPSNEAVDSLRDGR
LIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMANQVLAVNISEEGRILLGPE
GVPLQRVDVMAANGVIHMLDGILLPPTILPILPKHCSEEQHKIVAGSCVDCQALNTSTCP
PNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTIMEQGCCKGFFGPDCTQCPGGFSN
PCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGDQCQEDCSCVHGLCDNRPGSG
GVCQQGTCAPGFSGRFCNESMGDCGPTGLAQHCHLHARCVSQEGVARCRCLDGFEGDGFS
CTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGRVCVAIDECELDVRGGCHT
DALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHGLATCRAVGGGQRVCTCPP
GFGGDGFSCYGDIFRELEANAHFSIFYQWLKSAGITLPADRRVTALVPSEAAVRQLSPED
RAFWLQPRMLPNLVRAHFLQGALFEEELARLGGQEVATLNPTTRWEIRNISGRVWVQNAS
VDVADLLATNGVLHILSQVLLPPRGDVPGGQGLLQQLDLVPAFSLFRELLQHHRLVPQIE
AATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSMETLRKGGHRNSLLGPAHWI
VFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRCLHSHAEALREKCVNCTRR
FRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDCCPGFFGTLCEPCPGGLGG
VCSGHGQCQDRFLGSGECHCHEGFHGTACEVCELGRYGPNCTGVCDCAHGLCQEGLQGDG
SCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASTCACAAGYSGNGIFCSEVDP
CAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINSCLIHHGGCHIHAECIPTG
PQQVSCSCREGYSGDGIQTCELLDACSKNNGGCSPYATCKSTGDGQRTCTCDTAHTVGDG
LTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPHADLMSNLSQDELARIRAH
RQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGSIYLNDFARVVSSDHEAVN
GILHFIDRVLLPPEALHWEPDDAPIPRRNVTAAAQGFGYKIFSGLLKVASLLPLLREASH
RPFTMLWPTDATFRALPPDRQAWLYHEDHRDKLAAILRGHMIRNVEALASDLPNLGPLRT
MHGTPISFSCSRTRPGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDRFET
RPLRLNTCSICGLEPPCPEGSQEQGSPEACWRFYPKFWTSPPLHSLGLRSVWVHPSLWGR
PQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCSDRGVCMDGMSGSGQCLCR
SGFAGTACELCAPGAFGPHCQACRCTVHGRCDEGLGGSGSCFCDEGWTGPRCEVQLELQP
VCTPPCAPEAVCRAGNSCECSLGYEGDGRVCTVADLCQDGHGGCSEHANCSQVGTVVTCT
CLPDYEGDGWSCRARNPCTDGHRGGCSEHANCLSTGLNTRRCECHAGYVGDGLQCLEESE
PPVDRCLGQPPPCHSDAVCTDLHFQEKRAGVFHLQATSGPYGLNFSEAEAACEAQGAVLA
SFPQLSAAQQLGFHLCLMGWLVACRCRDGFVGDGISTCNGKLLDVLAATANFSTFYGMLL
GYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANASQ
GKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSHIIVWDIMAFNGIIHALASPLLAPP
QPQAVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRARGKPTGFGFSAFQAEDDADDDF
SPWQEGTNPTLVSVPNPVFGSDTFCEPFDDSLVEEGFLDTQWILTVK
Download sequence
Identical sequences 9598.ENSPTRP00000025911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]