SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000027253 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000027253
Domain Number 1 Region: 277-325
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000027253
Sequence length 331
Comment (Pan troglodytes)
Sequence
MENPSPAAALGKALCALLLATLGAAGQPLGGESVCSARAPAKYSITFTGKWSQTAFPKQY
PLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSV
HAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQA
ALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVT
LVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGPCGRLGTKS
RTRYVRVQPANNGSPCPELEEEAECVPDNCV
Download sequence
Identical sequences G3QJR7 H2QP32
ENSPTRP00000027253 XP_004038367.1.27298 XP_009445472.1.37143 XP_016808203.1.37143 9598.ENSPTRP00000027253 ENSPTRP00000027253 ENSGGOP00000002670 ENSGGOP00000002670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]