SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000027785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000027785
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family EGF-type module 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000027785
Sequence length 178
Comment (Pan troglodytes)
Sequence
MDRAARGSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRHKRKKKEEEMETLDKDITPVNEDIEETNIA
Download sequence
Identical sequences H2QPP5
ENSPTRP00000027785 ENSPTRP00000027785 XP_008955970.1.60992 XP_009446008.1.37143 9598.ENSPTRP00000027785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]