SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000027929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000027929
Domain Number 1 Region: 513-663
Classification Level Classification E-value
Superfamily EF-hand 1.75e-50
Family Osteonectin 0.00000203
Further Details:      
 
Domain Number 2 Region: 458-510
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000347
Family Ovomucoid domain III-like 0.00054
Further Details:      
 
Domain Number 3 Region: 431-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000044
Family Follistatin (FS) module N-terminal domain, FS-N 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000027929
Sequence length 664
Comment (Pan troglodytes)
Sequence
MKTGLFFLCLLGTAAAIPTNGRLLSDHSKPTAETVAPDDTAIPSLRAEDEENEKETAVST
EDDSQRKAEKSSVLKSKEESHEQSAEQGKSSSQELGLKDQEDSDGDLSVNLEYAPTEGTL
DIKEDMSEPQEKKLSENTDFLAPGVSSFTDSNQQESITKREENQEQPRNYSHHQLNRSSK
HSQGLRDQGNQEQDPNISNGEEEEEKGPGEVGTHNDNQERKTELPREHANSKQEEDNTQS
DDILEESDQPTQVSKMQEDEFDQGNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKT
GLEAISNHKETDEKTVSEALLMEPTDDGNITPRNHGVDDDGNDDGDDGGTDGPRHSASDD
YFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTSEPGEHQEAKKAENSSNEEETS
SEGNMRVHGVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYA
SSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYE
ANSEHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELD
QHPMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDE
NLLF
Download sequence
Identical sequences H2QPU9
9598.ENSPTRP00000027929 ENSPTRP00000027929 ENSPTRP00000027929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]