SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000028436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000028436
Domain Number 1 Region: 288-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.84e-56
Family SPRY domain 0.0000233
Further Details:      
 
Domain Number 2 Region: 4-79
Classification Level Classification E-value
Superfamily RING/U-box 1.3e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000259
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000028436
Sequence length 471
Comment (Pan troglodytes)
Sequence
MEFVTALVNLQEESSCPICLEYLKDPVTINCGHNFCRSCLNVSWKDLDDTFPCPVCRFCF
PYKSFRRNPQLRNLTEIAKQLQIRRSKRKRRKENAVCEKHNQFLTLFCVKDLEILCTQCS
FSTKHQKHYICPIKKAASYHREILEGSLEPLKNNIERVEKVIILQGSKSVELKKKVEYKR
EEINSEFEQIRLFLQNEQEMILRQIQDEEMNILAKLNENLVELSDYVSTLKHLLREVEGK
SVQSNLELLTHVKSMQHKYQNLKRPELFSFRLTKYGFSLPPQYSGLDRIIKPFQVDVILD
LDTAHPQLLVSEDRKAVRYERKKRNICYDPRRFYVCPAVLGSQRFSSGRHYWEVEVGNKP
KWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSKIGIFLD
YELGDLSFYNMNDRSILYTFNDCFTEAVWPYFYTGTDSKPLKVCSVSDSER
Download sequence
Identical sequences A0A2J8MQG7
ENSPTRP00000028436 ENSPTRP00000028436 9598.ENSPTRP00000028436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]