SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000029321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000029321
Domain Number 1 Region: 101-206
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-36
Family Second domain of FERM 0.0000433
Further Details:      
 
Domain Number 2 Region: 204-351
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-35
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 9-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-19
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000029321
Sequence length 686
Comment (Pan troglodytes)
Sequence
MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLR
YCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVK
QDVLQGRLPCPVNIAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERI
HKTLMGQIPSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVG
KYFWPRITKVHFKETQFELRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPEN
ESNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQ
PAESNSISRITANMENGENEGTTKIIAPSPVKSFKKAKNENSPDTQRSKSHAPWEENGPQ
SGLYNSPSDRTKSPKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRC
NTSSGSESENSNREHRKKRNRIRQENDMVDSAPQWEAVLRRQKEKNQADPNNRRSRHRSR
SRSPDIQAKEELWKHIQKELVDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQY
RRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQGSGDATVHQRRNGSKDSLMEEKPQT
STNNLAGKHTAKTIKTIQASRLKTET
Download sequence
Identical sequences H2QRB4
ENSPTRP00000029321 XP_001143134.1.37143 XP_003826790.1.60992 ENSPTRP00000029321 9598.ENSPTRP00000029321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]