SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000029913 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000029913
Domain Number 1 Region: 34-217,296-464
Classification Level Classification E-value
Superfamily L domain-like 4.68e-62
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 505-663,717-771
Classification Level Classification E-value
Superfamily L domain-like 1.36e-42
Family Ngr ectodomain-like 0.00058
Further Details:      
 
Domain Number 3 Region: 1050-1240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-39
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 905-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000872
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 938-1064
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000769
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 863-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 820-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000336
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 8 Region: 1324-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000029913
Domain Number - Region: 1277-1314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1243-1274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00171
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000029913
Sequence length 1431
Comment (Pan troglodytes)
Sequence
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIP
RNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNK
LQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRAL
RDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFT
LCMAPVHLRGFNVADVQKKEYVCPAPHLEPPSCNANSISCPSPCTCSNNIVDCRGKGLME
IPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSL
VLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKS
KKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYVTDLRLN
DNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRV
FRGLSGLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINL
LSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDILSYNRLR
CIPVHAFNGLRSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWV
KAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVDINIVAKCNACLSSPCKNNGTCT
QDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQR
CEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAKCI
PLDKGFRCECVPGYSGKLCETDNDDCVAHKCRHGAQCMDTINGYTCTCPQGFSGPFCEHP
PPMVLLQTSPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELA
SAKVRPQANISLQVATDKDNGILLYKGDNDPLALELYQGHVRLVYDSLSSPPTTVYSVET
VNDGQFHSVELVTLNQTLNLVVDKGTPKSLGKLQKQPAVGINSPLYLGGIPTSTGLSALR
QGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVV
CECHPGWTGPLCDQEARDPCLGHSCHHGKCVASGTSYMCKCAEGYGGALCDNKNDSANAC
SAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATASK
VPIMECRGGCGPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCLACS
Download sequence
Identical sequences 9598.ENSPTRP00000029913 ENSPTRP00000029913 ENSPTRP00000029913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]