SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000030147 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000030147
Domain Number 1 Region: 332-500
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-57
Family SPRY domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 20-106
Classification Level Classification E-value
Superfamily RING/U-box 1.32e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 127-185
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.01e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000030147
Sequence length 503
Comment (Pan troglodytes)
Sequence
MAAVGPRTGPGTGAEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIGRCWERP
GAGSVGAATRAPPFPLPCPQCREPARPSQLRPNRQLAAVATLLRRFSLPAAAPGEHGSQA
AAARAAAARCGQHGEPFKLYCQDDGRAICVVCDRAREHREHAVLPLDEAVQEAKELLESR
LRVLKKELEDCEVFRSTEEKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEE
LSREVAQKQNENLAQLGAEITQLSKLSSQIQETAQKPDLDFLQCSNVPGPKPTTVSSEMK
NKVWNVSLKTFVLKGMLKKFKEDLRGELEKEEKVELTLDPDTANPRLILSLDLKSVRLGE
RAQDLPNHPCRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVARESVRRKGLTPFTP
EEGVWALQLNGGQYWAVTSPERSPLSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRV
NFQERVFPLFSVCSTGTYLRIWP
Download sequence
Identical sequences ENSPTRP00000030147 ENSPTRP00000030147 9598.ENSPTRP00000030147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]