SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000030382 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000030382
Domain Number 1 Region: 285-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-60
Family SPRY domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 10-86
Classification Level Classification E-value
Superfamily RING/U-box 1.39e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 89-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000029
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000030382
Sequence length 465
Comment (Pan troglodytes)
Sequence
MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCP
QCRAPFHMDSLRPNKQLGSLIEALKEMDQEMSCEEHGEQLHLFCEDEGQLICWRCERAPQ
HKGHTTALVEDVCQGYKEKLQKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIR
SDFKNLQCFLHEEEKSYLWRLEKEEQQTLNRLRDYEAGLGLKSNELKSHILELEEKCQGS
AQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDT
AHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRCYFEVDVGEGTGWD
LGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPASLHLHEQPLLVGIFLDYEA
GVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD
Download sequence
Identical sequences H2QSE9
9598.ENSPTRP00000030382 ENSPTRP00000030382 ENSPTRP00000030382 XP_003950785.1.37143 XP_016810510.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]