SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000030472 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000030472
Domain Number 1 Region: 48-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-38
Family SCAN domain 0.0000688
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 488-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 216-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000131
Family KRAB domain (Kruppel-associated box) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000030472
Sequence length 546
Comment (Pan troglodytes)
Sequence
MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVSAPCSPARGPERSRQRFRGFR
YPEAAGPREALSRLRELCGQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPES
GEEVVVLLEYLERQLDEPAPQVPVGDQGQELLCCKMALLTQTQGSQSSQCQPMKALFKHE
SLGSQPLQDRVLQVPGLAQGGCCREDAMVASRLTPGSQGLLKMEDVALTLTPGWTQLDSS
QVNLYRDEKQESHSSLVSLGGEIQTKSRDLPPVKKLPEKEHGKISCHLREDIAQIPTHEE
AGEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIG
SSALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSL
LEHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKNVQNPEHGESWESQGRTESQWE
NTEAPVSYKCNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVG
KKTLSQ
Download sequence
Identical sequences A0A2I3S4K0
ENSPTRP00000030472 XP_527296.1.37143 ENSPTRP00000030472 9598.ENSPTRP00000030472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]