SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000030482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000030482
Domain Number 1 Region: 39-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-38
Family SCAN domain 0.0000708
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 396-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 312-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 480-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 210-254
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000889
Family KRAB domain (Kruppel-associated box) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000030482
Sequence length 538
Comment (Pan troglodytes)
Sequence
MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGP
REALSRLRELCRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVL
LEYLERQLDEPAPQVSGVDQGQELLCCKMALLTPAPGSQSSQFQLMKALLKHESLGSQPL
QDRVLQVPMLAHGGCCREDAVVASRLTPESRGLLKVEDVALTLTPEWTQQDSSQGNLCRD
EKQENHGSLVSLGDEKQTKSRDLPPAEELPEKEHGKISCHLREDIAQIPTCAEAGEQEGR
LQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKAFIGSSALVIH
QRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMEGQLENVETPMSY
KCNECERSFTQNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ
Download sequence
Identical sequences A0A2I3TBR3
ENSPTRP00000030482 XP_001141819.1.37143 XP_009449000.1.37143 XP_016810583.1.37143 9598.ENSPTRP00000030482 ENSPTRP00000030482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]