SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000030589 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000030589
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 3.79e-23
Family Ribosomal protein S18 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000030589
Sequence length 258
Comment (Pan troglodytes)
Sequence
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKMPP
RTPAEASSTGQTGPQSAL
Download sequence
Identical sequences K6ZHC4 Q1XHY1
ENSPTRP00000030589 NP_001035204.1.37143 XP_008957721.1.60992 9598.ENSPTRP00000030589 ENSPTRP00000030589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]