SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000031762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000031762
Domain Number 1 Region: 32-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 95-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000419
Family Fibronectin type I module 0.017
Further Details:      
 
Domain Number 3 Region: 197-242
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000031762
Sequence length 349
Comment (Pan troglodytes)
Sequence
MTAASVGPVRVAFVLLLALCSRPAVGQNCSGPCRCSDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMMRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences H2QTR1
9598.ENSPTRP00000031762 ENSPTRP00000031762 ENSPTRP00000031762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]