SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000032170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000032170
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-18
Family Calponin-homology domain, CH-domain 0.00034
Further Details:      
 
Domain Number 2 Region: 65-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000627
Family LIM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000032170
Sequence length 744
Comment (Pan troglodytes)
Sequence
MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFNALKKENIYE
NNKLCKQCSCTLHSGAYRATGEPGTFVCTSHLPAAASASPKLTGLVPRQPGAMGVDSRTS
CSPQKAQEANKARPSAWEPAAGNSPARASVPAAPNPAATSATSVHVRSPARPSESRLAPT
PTEGKVRPRVTNSSPMGWSSAAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTT
LSSSSTSAATVDPPAWTPSASRTQQARNKFFQTSAVPPSTSLAGRGPTPSLALSRDGFNE
HVRNFLQDLSPLVEAGTPAPDRPSPATAPVPSSQPKTEAAQASPLAKPLQSSSPRALGLP
SRMEPPAPLSTSSTSQASVLPPAGRRNLAESSGVGRVGAGSRPKPEAPKAKGKSTTLTQD
MSASPQEEKEDGPAGWRANLTLKPKEPQALAEPRAGEAPRKVSGSFAGSVHITLTPVRPD
RTPRPGSPGPSLPARSPSPPRRRRLAVPASLDVSDNWLRPEPPGQEARVQSWKEEEKKPH
LQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELE
KRLRAAEGDDAEDSLMVDWFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLM
AKPEALKSLQERRREQELLERYVSTVNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQ
RKKSKFGLSKIWSPKSKSKSSPSQ
Download sequence
Identical sequences 9598.ENSPTRP00000032170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]