SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000032293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000032293
Domain Number 1 Region: 63-256
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-79
Family Sec7 domain 0.00000000659
Further Details:      
 
Domain Number 2 Region: 265-380
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-34
Family Pleckstrin-homology domain (PH domain) 0.000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000032293
Sequence length 400
Comment (Pan troglodytes)
Sequence
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYT
TDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYR
ISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences A0A096NQ83 A0A2J8R559 O43739
9598.ENSPTRP00000032293 ENSNLEP00000001385 ENSP00000379967 XP_009240803.1.23681 XP_012351774.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]