SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000033287 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000033287
Domain Number 1 Region: 35-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.74e-37
Family SCAN domain 0.000064
Further Details:      
 
Domain Number 2 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.35e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 481-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 224-258
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000183
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000033287
Sequence length 545
Comment (Pan troglodytes)
Sequence
MLKEHPEMAEAPQQQLGIPVVKLEKELPWGRGREDPSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRRWLRPELHTKEQILELLVLEQFLTILPCEFYAWIREHGPESGKALAAMVEDL
TERALEAKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEE
QLSQDPGDETRAFQEQALPVLQAGPGLPAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFP
EEEWRHVTPAQIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVALTSERFGEAS
LQGPGLGRVCEQEPGGPAGSAPGLPPPQHGAIPLPDEVKTHSSFWKPFQCPECGKGFSRS
SNLVRHQRTHEEEKSYGCVECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHHLE
VHQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHRRA
HTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQ
EPLVQ
Download sequence
Identical sequences H2QV05
ENSPTRP00000033287 9598.ENSPTRP00000033287 XP_003318673.1.37143 XP_008966984.1.60992 XP_008966985.1.60992 XP_014201224.1.60992 XP_014201225.1.60992 XP_014201226.1.60992 XP_016813307.1.37143 XP_016813308.1.37143 XP_016813309.1.37143 XP_016813310.1.37143 ENSPTRP00000033287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]