SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000033315 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000033315
Domain Number 1 Region: 50-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.1e-38
Family SCAN domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 386-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.5e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 222-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000693
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Domain Number 6 Region: 355-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000274
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000033315
Sequence length 563
Comment (Pan troglodytes)
Sequence
MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSTLQDTPPADPEIFRQRFR
RFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATQSHF
KHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEE
WGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKE
FGEKRDQEGKTGERQQKNPEEKTGKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSL
SSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQ
RIHTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHA
RERASEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences H2QV13
ENSPTRP00000033315 ENSPTRP00000033315 9598.ENSPTRP00000033315 XP_001144424.1.37143 XP_003815781.2.60992 XP_009452024.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]