SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000033319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000033319
Domain Number 1 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 46-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-21
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 377-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 173-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000599
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000033319
Sequence length 446
Comment (Pan troglodytes)
Sequence
METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYF
IRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDI
SQGLKFKEAYEREVSLKRPLGNSPGERLNRKMPDFGQVTVEEKLTPRGERSEKYNDFGNS
FTVNSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQS
SHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLT
HHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQR
IHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTG
EKPLNGIGMSKSSLRVTTELNIRDST
Download sequence
Identical sequences K7DF23
9598.ENSPTRP00000033319 XP_003318679.1.37143 XP_003318682.1.37143 XP_009452018.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]