SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000034599 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000034599
Domain Number 1 Region: 298-561
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.7e-87
Family Eukaryotic proteases 0.00000000047
Further Details:      
 
Domain Number 2 Region: 105-210
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-32
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 3 Region: 213-301
Classification Level Classification E-value
Superfamily Kringle-like 1.33e-31
Family Kringle modules 0.00000557
Further Details:      
 
Domain Number 4 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 2.82e-20
Family Fibronectin type I module 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000034599
Sequence length 562
Comment (Pan troglodytes)
Sequence
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSVLAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYTSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
Download sequence
Identical sequences K7ATB3
ENSPTRP00000034599 9598.ENSPTRP00000034599 ENSPTRP00000034599 XP_009453544.1.37143 XP_528120.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]