SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000034915 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000034915
Domain Number 1 Region: 6-81
Classification Level Classification E-value
Superfamily L domain-like 0.0000000442
Family Ngr ectodomain-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000034915
Sequence length 191
Comment (Pan troglodytes)
Sequence
MTERLLIKALSGGKNTKILTLNGKKMTKMPSALGKLPGLKTLVLQNNLIPKVCPELCNLT
QFQDLKLREFYCEGNPLFLQQPVISTQQENVWSLQEITSRFVMNQLAENNPFLMDGIERY
PQVRSMISQGKTCAICGQYFITVWLECVRFVPPPKDWKISKNLKLVPLQVLICSYKCFTQ
RDPNLFGIAQV
Download sequence
Identical sequences H2QWF3
ENSPTRP00000034915 ENSPTRP00000034915 9598.ENSPTRP00000034915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]