SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000035287 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000035287
Domain Number 1 Region: 98-180
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000458
Family Snake venom toxins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000035287
Sequence length 223
Comment (Pan troglodytes)
Sequence
MGLQRPRQAPAGGRRAPRGRRGSPYRPDPGRGARRLRRFQKGGEGASRADPHWASLGTMA
LLALLLVVALPRVWTDANLTARQRDPEDTQQTDEGDNRVWCHVCERENTFECQNPRRCKW
TEPYCVIAAVKIFPRFFVISKQCSAGCAATERPKPEEKWFLLEEPMPFFYLKCCKIRYCN
LEGPPINSSVFKEYAGSMGESCGGLWMAILLLLASIAAGLSLS
Download sequence
Identical sequences ENSPTRP00000035287 9598.ENSPTRP00000035287 ENSPTRP00000035287 XP_519990.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]