SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000038828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000038828
Domain Number 1 Region: 854-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000916
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 2 Region: 678-735
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 736-792
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 915-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000129
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 52-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 796-849
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 7 Region: 625-675
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000589
Family TSP-1 type 1 repeat 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000038828
Sequence length 1017
Comment (Pan troglodytes)
Sequence
MVSHFMGSLSVLCFLLLLGFQFVCPQPSTQHRKVPQRMVAEGAPEDGGGGAPGVWGAWGP
WSACSRSCSGGVMEQTRPCLPRSYRLRGGQRPGAPARAFADHVVSAVRTSVPLHRSRDET
PALASTDASRQGPTVLRGSRHPQPQGLEVTGDRRSRTRGTIGPGKYGYGKAPYILPLQTD
TAHTPQRLRRQKLSSRHSRSQGASSARHGYSSPAHQVPQHGPLYQSDSGPHSGLQAAEAP
IYQLPLTHDQGYPAASSLFHSPETSNNHGVGTHGATQSFSQPARSTAISCIGAYRQYKLC
NTNVCPESSRSIREVQCASYNNKPFMGRFYEWEPFAEVKGNRKCELNCQAMGYRFYVRQA
EKVIDGTPCDQNGTAICVSGQCKSIGCDDYLGSDKVVDKCGVCGGDNTGCQVVSGVFKHA
LTSLGYHRVVEIPEGATKINITEMYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGTM
FTYKRPNEISSTAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVIMGTNAISPQVPPHR
RPGEPFNGQMVTEGRSQEEGEEKGRNEEKEDLRGEAPEMFTSESAQTFPVRHPDRFSPRR
PDNLVPPAPQPPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRSTHEEAPESYCDSS
MKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQH
LEKPETTSTCQLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLR
PNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPAE
ATPCDNGPCTGKVEWFAGSWSQCSIECGSGTQQREVICVRKNADTFEVLDPSECSFLEKP
PSQQSCHLKPCGAKWFSTEWSMCSKSCQGGFRVREVRCLSDDMTLSNLCDPQLKPEERES
CNPQDCVPEVDENCKDKYYNCNVVVQARLCVYNYYKTACCASCTRVANRQTGFLGSR
Download sequence
Identical sequences ENSPTRP00000038828 9598.ENSPTRP00000038828 ENSPTRP00000038828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]