SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000040827 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000040827
Domain Number 1 Region: 397-577
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-36
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 9-128
Classification Level Classification E-value
Superfamily Cadherin-like 2e-21
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 122-212
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000628
Family Cadherin 0.0046
Further Details:      
 
Domain Number 4 Region: 673-710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000177
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 598-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 6 Region: 635-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000040827
Domain Number - Region: 367-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.039
Family Laminin-type module 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000040827
Sequence length 1164
Comment (Pan troglodytes)
Sequence
MSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFS
ILSGNEEEEFVLDPHGILRSAVVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEES
THKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNSHDGKI
IALGGLDSGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDFVGLH
MHGFRRTLRNAVLTQKQDSLRIISIQPVTGTNQLDMLFAVEMHSSEFYKPAYLIQKLSNA
RRHLENIMRISAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYRNVRC
TCNGGLCPGSNDPCMEKPCPGDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFAGNSY
IKYRLSENSKEEDFKLALRLRTLQSNGIIMYTRANPCIILKIVDGKLWFQLDCGSGPGIL
GISGRAVNDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSTESSIYFGALVQAD
NIRSLTDTRVTQVLSGFQGCLDSVILNNNELPLQNKRSSFAEVVGLTELKLGCVLYPDAC
ERSPCQHGGSCTGLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICN
CKAGLTGVTCEEDINECEREECENGGSCVNVFGSFLCNCTPGYVGQYCGLRPVVVPNIQA
GHSYVGKEELIGIAVVLFVIFILVVLFIVFRKKVFRKNYSRNNITLVQDPATAALLNKSN
GIPFRNLRGSGDGRNVYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKIVDGLGGEHQEMTT
FHPESPRILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKNGWDAGTENKGVDDPGEVTCF
AGSNKGSNSEVQSLSSFQSDSGDDNASIVTVIQLVNNVVDTIENEVSVMDQGQNYNRAYH
WDTSDWMPGARLSDIEEVPNYENQDGGSAHQGSTRELESDYYLGGYDIDSEYPPPHEEEF
LSQDQLPPPLPEDFPDQYEALPPSQPVSLASTLSPDCRRRPQFHPSQYLPPHPFPNETDL
VGPPASCEFSTFAVSMNQGTEPTGPADSVSLSLHNSRGTSSSDVSANCGFDDSEVAMSDY
ESVGELSLASLHIPFVETQHQTQV
Download sequence
Identical sequences 9598.ENSPTRP00000040827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]