SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000043543 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000043543
Domain Number 1 Region: 32-116
Classification Level Classification E-value
Superfamily F-box domain 1.46e-16
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 98-259,332-391
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000769
Family 28-residue LRR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000043543
Sequence length 428
Comment (Pan troglodytes)
Sequence
MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
Download sequence
Identical sequences A0A2K5S914 G3QVS1 H2NK32 H2R286 Q9UKT7
ENSP00000347834 ENSPPYP00000006181 NP_036290.1.87134 NP_036290.1.92137 XP_003825292.1.60992 XP_005266393.1.92137 XP_009246982.1.23681 XP_009246983.1.23681 XP_016780467.1.37143 XP_017354321.1.71028 XP_017354322.1.71028 XP_018895155.1.27298 ENSPTRP00000043543 ENSP00000347834 HR2963 gi|16306584|ref|NP_036290.1| ENSPTRP00000043543 4i6j_B 9598.ENSPTRP00000043543 9600.ENSPPYP00000006181 9606.ENSP00000347834 ENSPPYP00000006181 ENSP00000347834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]