SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000044343 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000044343
Domain Number 1 Region: 728-1080
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.98e-54
Family Ankyrin repeat 0.0000603
Further Details:      
 
Domain Number 2 Region: 221-409,440-521
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.32e-45
Family Ankyrin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 449-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.18e-45
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 4 Region: 48-157
Classification Level Classification E-value
Superfamily POZ domain 8.37e-22
Family BTB/POZ domain 0.0066
Further Details:      
 
Domain Number 5 Region: 1105-1164
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.69e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000044343
Sequence length 1170
Comment (Pan troglodytes)
Sequence
MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVAD
LYEQEQYSDLKIKVGDRHISAHKFVLAARSDSWSLANLSSTKELDLSDANPEVTMTMLRW
IYTDELEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNAS
TLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIE
MDSQLPGKLNEADHNGDLALDLALSRRLESIATTLVTHKADVDMVDKSGWSLLHKGIQRG
DLFAATFLIKNGALVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANP
NMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSV
NPFEDIPVVNGTSFDENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLATN
GAHVNHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPREAAPLTSLADS
VHLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTG
MHTIAAQLLGSGAAINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVSRTQDGETAL
QLAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDSTCWGP
GPGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAAS
WGLEETVQCLLEFGANVNAQDAEGRTPIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLT
PFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNS
RVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLL
ENGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKE
NAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVN
IFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTAKFGVTTRKHHCRHCGRLLCHKCST
KEIPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences H2R2R7
9598.ENSPTRP00000044343 ENSPTRP00000044343 ENSPTRP00000044343 XP_001160079.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]