SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000046097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000046097
Domain Number 1 Region: 539-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.00083
Further Details:      
 
Domain Number 2 Region: 37-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000837
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 3 Region: 98-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000118
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000046097
Domain Number - Region: 493-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0163
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000046097
Sequence length 584
Comment (Pan troglodytes)
Sequence
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETDRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLKELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTETARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQSC
Download sequence
Identical sequences A0A2J8NHW2
9598.ENSPTRP00000046097 ENSPTRP00000046097 ENSPTRP00000046097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]